PPIRE10291
Target Protein Information
| Protein_Name | 14-3-3 protein zeta/delta |
|---|---|
| Protein_Sequence | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
| Organism_Source | Homo sapiens |
| Functional_Classification | 14-3-3 proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAZ |
| UniProt_ID | P63104 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | aSS8 |
|---|---|
| Peptide_Sequence | QGXLDAXDLAS |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)CNC(=O)[C@@H](N)CCC(N)=O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | X3/X7=8-carbon hydrocarbon cross-link |
| Cyclization_Method | Side chain-side chain cyclization; X3<->X7; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Peg-Fitc |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1003.03 |
|---|---|
| Aliphatic_Index | 89.09091 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -2.00112 |
| Isoelectric_Point | 3.49188 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 492.24000 |
| X_logP_energy | -7.52030 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Constrained peptides with target-adapted cross-links as inhibitors of a pathogenic protein-protein interaction. |
| Release_Year | 2014 |
| PMID | 24504455 |
| DOI | 10.1002/anie.201310082 |