PPIRE10320
Target Protein Information
| Protein_Name | Tumor necrosis factor ligand superfamily member 11 |
|---|---|
| Protein_Sequence | MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
| Organism_Source | Mus musculus |
| Functional_Classification | TNF family ligand |
| Cellular_Localization | Extracellular |
| Gene_Names | Tnfsf11 |
| UniProt_ID | O35235 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | OP3-4 |
|---|---|
| Peptide_Sequence | YCEIEFCYLIR |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)CC)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C2<->C7; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1451.72 |
|---|---|
| Aliphatic_Index | 106.36364 |
| Aromaticity | 0.27273 |
| Average_Rotatable_Bonds | 4.09091 |
| Charge_at_pH_7 | -1.12412 |
| Isoelectric_Point | 4.25807 |
|---|---|
| Hydrogen_Bond_Acceptors | 19 |
| Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 531.28000 |
| X_logP_energy | -0.62363 |
Interaction Information
| Affinity | KD=284.4 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL)inhibitor peptide and molecular basis for osteopetrosis. |
| Release_Year | 2010 |
| PMID | 21059944 |
| DOI | 10.1073/pnas.1011686107 |