PPIRE10331
Target Protein Information
| Protein_Name | Mu-type opioid receptor |
|---|---|
| Protein_Sequence | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI |
| Organism_Source | Cavia porcellus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | OPRM1 |
| UniProt_ID | P97266 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | c[Asp3-Lys7]Dyn A(1-11)-NH2 |
|---|---|
| Peptide_Sequence | YGDFLRKIRPK |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | side chain-side chain cyclization; D3<->K7; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1392.67 |
|---|---|
| Aliphatic_Index | 70.90909 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 4.18182 |
| Charge_at_pH_7 | 2.99698 |
| Isoelectric_Point | 10.88576 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 578.90000 |
| X_logP_energy | -3.07366 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design, synthesis, and biological activities of cyclic lactam peptide analogues of dynorphine A(1-11)-NH2 |
| Release_Year | 1996 |
| PMID | 8676350 |
| DOI | 10.1021/jm950369c |