PPIRE10374
Target Protein Information
| Protein_Name | CHD9 neighbor protein |
|---|---|
| Protein_Sequence | MGCHSSKSTTVAAESQKLEEEREGREPGLETGTQAADCKDAPLKDGTPEPKS |
| Organism_Source | Homo sapiens |
| Functional_Classification | ATP-dependent chromatin-remodeling factor |
| Cellular_Localization | Nucleus |
| Gene_Names | CHD9NB |
| UniProt_ID | A0A1B0GV96 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3K4me3 |
|---|---|
| Peptide_Sequence | ARTKQTARKST |
| Peptide_Length | 11 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | K4=trimethylation |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1247.42 |
|---|---|
| Aliphatic_Index | 18.18182 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 3.99739 |
| Isoelectric_Point | 12.53175 |
|---|---|
| Hydrogen_Bond_Acceptors | 21 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 654.17000 |
| X_logP_energy | -10.52916 |
Interaction Information
| Affinity | KD=28 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1. |
| Release_Year | 2014 |
| PMID | 24853335 |
| DOI | 10.1038/ncomms4952 |