PPIRE10626
Target Protein Information
| Protein_Name | Chromobox protein homolog 3 |
|---|---|
| Protein_Sequence | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromodomain-containing proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | CBX3 |
| UniProt_ID | Q13185 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | G9aK185me2 |
|---|---|
| Peptide_Sequence | KVHRARKTMSKP |
| Peptide_Length | 12 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1438.76 |
|---|---|
| Aliphatic_Index | 32.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.16667 |
| Charge_at_pH_7 | 5.08800 |
| Isoelectric_Point | 12.54608 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 645.63000 |
| X_logP_energy | -7.08126 |
Interaction Information
| Affinity | KD=9 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a. |
| Release_Year | 2012 |
| PMID | 22514736 |
| DOI | 10.1371/journal.pone.0035376 |