PPIRE10632
Target Protein Information
| Protein_Name | Phospholipase A2, membrane associated |
|---|---|
| Protein_Sequence | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC |
| Organism_Source | Homo sapiens |
| Functional_Classification | phospholipases |
| Cellular_Localization | Extracellular |
| Gene_Names | PLA2G2A |
| UniProt_ID | P14555 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 6 |
|---|---|
| Peptide_Sequence | LGRVDIHVWDGV |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](N)CC(C)C)C(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@H](C(=O)O)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1365.55 |
|---|---|
| Aliphatic_Index | 137.50000 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -0.91022 |
| Isoelectric_Point | 5.40814 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 564.39000 |
| X_logP_energy | -3.04343 |
Interaction Information
| Affinity | IC50=5.95 uM |
|---|---|
| Affinity_Assay | 1H NMR spectroscopy |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Novel peptide inhibitors of human secretory phospholipase A2 with antiinflammatory activity: solution structure and molecular modeling. |
| Release_Year | 2007 |
| PMID | 17973469 |
| DOI | 10.1021/jm070385x |