PPIRE10697
Target Protein Information
| Protein_Name | Dynein light chain 1, cytoplasmic |
|---|---|
| Protein_Sequence | MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG |
| Organism_Source | Drosophila melanogaster |
| Functional_Classification | motor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | ctp |
| UniProt_ID | Q24117 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ana2 peptide 2 |
|---|---|
| Peptide_Sequence | NYSSTTGTQCDI |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CC(N)=O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1289.34 |
|---|---|
| Aliphatic_Index | 32.50000 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.33333 |
| Charge_at_pH_7 | -1.06439 |
| Isoelectric_Point | 3.74997 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 628.28000 |
| X_logP_energy | -10.97070 |
Interaction Information
| Affinity | KD=12.8 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4QH8 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The mechanism of dynein light chain LC8-mediated oligomerization of the Ana2 centriole duplication factor. |
| Release_Year | 2014 |
| PMID | 24920673 |
| DOI | 10.1074/jbc.M114.576041 |