PPIRE10751
Target Protein Information
| Protein_Name | Cathepsin E |
|---|---|
| Protein_Sequence | MKPLFVLLLLLLLLDLAQAQGVLHRVPLRRHQSLRKKLRAQGQLSDFWRSHNLDMIEFSESCNVDKGINEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSSTYMEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVEGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQGYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPKKIKQLQEAIGATPMDGEYAVDCATLNMMPNVTFLINGVSYTLSPTAYILPDLVDGMQFCGSGFQGLDIQPPAGPLWILGDVFIRKFYSVFDRGNNQVGLAPAVP |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | aspartic proteases |
| Cellular_Localization | Lysosome |
| Gene_Names | Ctse |
| UniProt_ID | P16228 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pi101 |
|---|---|
| Peptide_Sequence | SCGGIIIISCIA |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H](N)CO)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1149.43 |
|---|---|
| Aliphatic_Index | 170.83333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.08333 |
| Charge_at_pH_7 | -0.12597 |
| Isoelectric_Point | 5.82601 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 423.88000 |
| X_logP_energy | -3.91150 |
Interaction Information
| Affinity | Ki=5 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development of systemic in vitro evolution and its application to generation of peptide-aptamer-based inhibitors of cathepsin E. |
| Release_Year | 2009 |
| PMID | 19150354 |
| DOI | 10.1016/j.jmb.2008.12.028 |