PPIRE10813
Target Protein Information
| Protein_Name | Protein S100-B |
|---|---|
| Protein_Sequence | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | S100 proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | S100b |
| UniProt_ID | P04631 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | mono-aib-TRTK |
|---|---|
| Peptide_Sequence | TRTKIDWXKILX |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)O |
| Chemical_Modification | B8=a-aminoisobutyric acid; B12=a-aminoisobutyric acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1387.64 |
|---|---|
| Aliphatic_Index | 97.50000 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.91667 |
| Charge_at_pH_7 | 1.99784 |
| Isoelectric_Point | 10.78901 |
|---|---|
| Hydrogen_Bond_Acceptors | 19 |
| Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 590.91000 |
| X_logP_energy | -4.38623 |
Interaction Information
| Affinity | KD=300 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Simultaneous inhibition of key growth pathways in melanoma cells and tumor regression by a designed bidentate constrained helical peptide. |
| Release_Year | 2014 |
| PMID | 24839139 |
| DOI | 10.1002/bip.22505 |