PPIRE11021
Target Protein Information
| Protein_Name | E3 ubiquitin-protein ligase SIAH1 |
|---|---|
| Protein_Sequence | MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin protein ligases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SIAH1 |
| UniProt_ID | Q8IUQ4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SIP(58-70)peptide |
|---|---|
| Peptide_Sequence | EKPAAVVAPITTG |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(=O)O)C(C)C)C(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1253.46 |
|---|---|
| Aliphatic_Index | 97.69231 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.76923 |
| Charge_at_pH_7 | -0.00054 |
| Isoelectric_Point | 6.40880 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 498.72000 |
| X_logP_energy | -4.96710 |
Interaction Information
| Affinity | KD=24 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2A25 |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural analysis of Siah1-Siah-interacting protein interactions and insights into the assembly of an E3 ligase multiprotein complex. |
| Release_Year | 2005 |
| PMID | 16085652 |
| DOI | 10.1074/jbc.M506707200 |