PPIRE11249
Target Protein Information
| Protein_Name | Macrophage metalloelastase |
|---|---|
| Protein_Sequence | MSCTLLKGVCTMKFLMMIVFLQVSACGAAPMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC |
| Organism_Source | Mus musculus |
| Functional_Classification | metalloendopeptidases |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Mmp12 |
| UniProt_ID | P34960 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Neurotensin |
|---|---|
| Peptide_Sequence | XLYENKPRRPYIL |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)CN)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | X1=pyroglutamic acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Pyroglutamate |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1618.90 |
|---|---|
| Aliphatic_Index | 90.00000 |
| Aromaticity | 0.15385 |
| Average_Rotatable_Bonds | 3.84615 |
| Charge_at_pH_7 | 1.99776 |
| Isoelectric_Point | 10.00649 |
|---|---|
| Hydrogen_Bond_Acceptors | 21 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 665.61000 |
| X_logP_energy | -3.70966 |
Interaction Information
| Affinity | IC50=11 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Analysis of binding sites and efficacy of a species-specific peptide at rat and human neurotensin receptors. |
| Release_Year | 1981 |
| PMID | 10667863 |
| DOI | 10.1034/j.1399-3011.2000.00153.x |