PPIRE11278
Target Protein Information
| Protein_Name | Phospholipid hydroperoxide glutathione peroxidase GPX4 |
|---|---|
| Protein_Sequence | MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF |
| Organism_Source | Homo sapiens |
| Functional_Classification | peroxidases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GPX4 |
| UniProt_ID | P36969 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | GXpep-2 |
|---|---|
| Peptide_Sequence | CRAWYQNYCALRR |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C1<->C9; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1702.97 |
|---|---|
| Aliphatic_Index | 45.38462 |
| Aromaticity | 0.23077 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 2.87232 |
| Isoelectric_Point | 9.41852 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 30 |
| Topological_Polar_Surface_Area | 740.65000 |
| X_logP_energy | -6.28729 |
Interaction Information
| Affinity | KD=0.61 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Discovery of GPX4 inhibitory peptides from random peptide T7 phage display and subsequent structural analysis. |
| Release_Year | 2016 |
| PMID | 27836545 |
| DOI | 10.1016/j.bbrc.2016.11.035 |