PPIRE11372
Target Protein Information
| Protein_Name | Microtubule-associated protein 1 light chain 3 alpha |
|---|---|
| Protein_Sequence | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAP1LC3A |
| UniProt_ID | Q9H492 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FYCO1 LIR |
|---|---|
| Peptide_Sequence | DDAVFDIITDEELC |
| Peptide_Length | 14 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CC(=O)O)C(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O)[C@@H](C)CC |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1597.71 |
|---|---|
| Aliphatic_Index | 111.42857 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 3.71429 |
| Charge_at_pH_7 | -6.05865 |
| Isoelectric_Point | 3.11604 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 685.65000 |
| X_logP_energy | -5.30340 |
Interaction Information
| Affinity | KD=0.54 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 5CX3 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis of FYCO1 and MAP1LC3A interaction reveals a novel binding mode for Atg8-family proteins. |
| Release_Year | 2016 |
| PMID | 27246247 |
| DOI | 10.1080/15548627.2016.1185590 |