PPIRE11416
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | WTAADMAAQITRRKWEQAGAAERDRAYLEGECVEWLRRYLKNGNATLLRTDPPKAHVTHHRRPEGDVTLRCWALGFYPADITLTWQLNGEELTQEMELVETRPAGDGTFQKWASVVVPLGKELKYTCHVEHEGPEPLTLRWGKEEPPSSTKTNTVIIAVPVVLGAVVILGAVMAFVMKRRRNTGGKGGDYALAPGSQSSDMSLPDCKV |
| Organism_Source | Mus musculus |
| Functional_Classification | MHC class I |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-D1 |
| UniProt_ID | Q31154 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | DAN-NP |
|---|---|
| Peptide_Sequence | TYQRTRALV |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Dansylation |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1107.28 |
|---|---|
| Aliphatic_Index | 86.66667 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.88889 |
| Charge_at_pH_7 | 1.99713 |
| Isoelectric_Point | 11.14762 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 523.70000 |
| X_logP_energy | -5.49936 |
Interaction Information
| Affinity | Ka=4.98E+05 1/M |
|---|---|
| Affinity_Assay | fluorescence spectroscopy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Real-time measurement of antigenic peptide binding to empty and preloaded single-chain major histocompatibility complex class I molecules. |
| Release_Year | 1993 |
| PMID | 8477806 |
| DOI | 10.1002/eji.1830230521 |