PPIRE11490
Target Protein Information
| Protein_Name | 14-3-3 protein gamma |
|---|---|
| Protein_Sequence | MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN |
| Organism_Source | Homo sapiens |
| Functional_Classification | adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAG |
| UniProt_ID | P61981 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | USP8pS718 |
|---|---|
| Peptide_Sequence | KLKRSYpSSPDITQ |
| Peptide_Length | 14 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | S7=phosphoserine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fitc-Beta-Alanine Linker |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1619.84 |
|---|---|
| Aliphatic_Index | 55.71429 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 3.71429 |
| Charge_at_pH_7 | 1.99699 |
| Isoelectric_Point | 10.24366 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 719.52000 |
| X_logP_energy | -8.62723 |
Interaction Information
| Affinity | KD=0.48 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 6F09 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Biophysical and structural insight into the USP8/14-3-3 interaction. |
| Release_Year | 2018 |
| PMID | 29473952 |
| DOI | 10.1002/1873-3468.13017 |