PPIRE11536
Target Protein Information
| Protein_Name | 14-3-3 protein zeta/delta |
|---|---|
| Protein_Sequence | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
| Organism_Source | Homo sapiens |
| Functional_Classification | scaffold proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAZ |
| UniProt_ID | P63104 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SOS1pSer1161 |
|---|---|
| Peptide_Sequence | PRRRPEXSAPAESS |
| Peptide_Length | 14 |
| Peptide_SMILES | C[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | X7=phosphoserine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1496.60 |
|---|---|
| Aliphatic_Index | 14.28571 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.28571 |
| Charge_at_pH_7 | 1.00152 |
| Isoelectric_Point | 10.30864 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 731.04000 |
| X_logP_energy | -11.69469 |
Interaction Information
| Affinity | KD=4.06 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 6F08 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural characterization of 14-3-3Zeta in complex with the human Son of sevenless homolog 1 (SOS1). |
| Release_Year | 2018 |
| PMID | 29408703 |
| DOI | 10.1016/j.jsb.2018.01.011 |