PPIRE11590
Target Protein Information
| Protein_Name | SH2 domain-containing protein 1B |
|---|---|
| Protein_Sequence | MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYSYRIFREKHGYYRIETDAHTPRTIFPNLQELVSKYGKPGQGLVVHLSNPIMRNNLCQRGRRMELELNVYENTDEEYVDVLP |
| Organism_Source | Mus musculus |
| Functional_Classification | SH2 domain-containing proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Sh2d1b |
| UniProt_ID | O35324 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CD150 pTyr281 peptide |
|---|---|
| Peptide_Sequence | VEKKSLTIXAQVQK |
| Peptide_Length | 14 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C |
| Chemical_Modification | X8=phosphotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1528.81 |
|---|---|
| Aliphatic_Index | 104.28571 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 1.99887 |
| Isoelectric_Point | 10.50692 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 683.62000 |
| X_logP_energy | -7.08790 |
Interaction Information
| Affinity | KD=131 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 1I3Z |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells. |
| Release_Year | 2001 |
| PMID | 11689425 |
| DOI | 10.1093/emboj/20.21.5840 |