PPIRE11596
Target Protein Information
| Protein_Name | Tumor necrosis factor |
|---|---|
| Protein_Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Organism_Source | Homo sapiens |
| Functional_Classification | tumor necrosis factor |
| Cellular_Localization | Extracellular |
| Gene_Names | TNF |
| UniProt_ID | P01375 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | T5 |
|---|---|
| Peptide_Sequence | VPPLLHELYLMYYT |
| Peptide_Length | 14 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1752.10 |
|---|---|
| Aliphatic_Index | 132.14286 |
| Aromaticity | 0.21429 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -0.91188 |
| Isoelectric_Point | 5.36332 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 570.94000 |
| X_logP_energy | 1.36290 |
Interaction Information
| Affinity | IC50=80 uM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of anti-TNFalpha peptides with consensus sequence. |
| Release_Year | 2003 |
| PMID | 14559240 |
| DOI | 10.1016/j.bbrc.2003.09.141 |