PPIRE11706
Target Protein Information
| Protein_Name | HLA class II histocompatibility antigen, DRB1 beta chain |
|---|---|
| Protein_Sequence | MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class II molecules |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-DRB1 |
| UniProt_ID | P01911 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pMART-1_100-114 |
|---|---|
| Peptide_Sequence | APPAYEKLXAEQSPP |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](C)N)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | X9=phosphoserine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1554.72 |
|---|---|
| Aliphatic_Index | 46.00000 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 2.86667 |
| Charge_at_pH_7 | -0.99961 |
| Isoelectric_Point | 4.25815 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 619.73000 |
| X_logP_energy | -5.98780 |
Interaction Information
| Affinity | IC50=102 nM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | 3L6F |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for the presentation of tumor-associated MHC class II-restricted phosphopeptides to CD4+ T cells. |
| Release_Year | 2010 |
| PMID | 20417641 |
| DOI | 10.1016/j.jmb.2010.04.037 |