PPIRE11844
Target Protein Information
| Protein_Name | Synaptotagmin-1 |
|---|---|
| Protein_Sequence | MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK |
| Organism_Source | Homo sapiens |
| Functional_Classification | C2 domain-containing proteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | SYT1 |
| UniProt_ID | P21579 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SV2A Cluster-2 phosphorylated peptide |
|---|---|
| Peptide_Sequence | EGGASSDAXEGHDED |
| Peptide_Length | 15 |
| Peptide_SMILES | C[C@H](NC(=O)CNC(=O)CNC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | X9=phosphothreonine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1432.29 |
|---|---|
| Aliphatic_Index | 13.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.20000 |
| Charge_at_pH_7 | -5.90444 |
| Isoelectric_Point | 3.53184 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 763.66000 |
| X_logP_energy | -13.28020 |
Interaction Information
| Affinity | KD=300 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4V11 |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Phosphorylation of synaptic vesicle protein 2A at Thr84 by casein kinase 1 family kinases controls the specific retrieval of synaptotagmin-1. |
| Release_Year | 2015 |
| PMID | 25673844 |
| DOI | 10.1523/JNEUROSCI.4248-14.2015 |