PPIRE11866
Target Protein Information
| Protein_Name | Tol-Pal system protein TolB |
|---|---|
| Protein_Sequence | MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL |
| Organism_Source | Escherichia coli (strain K12) |
| Functional_Classification | translocation proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | tolB |
| UniProt_ID | P0A855 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ColE9 Tpep32-47 |
|---|---|
| Peptide_Sequence | GASDGSGWSSENNPW |
| Peptide_Length | 15 |
| Peptide_SMILES | C[C@H](NC(=O)CN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1550.52 |
|---|---|
| Aliphatic_Index | 6.66667 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -1.99979 |
| Isoelectric_Point | 3.55007 |
|---|---|
| Hydrogen_Bond_Acceptors | 24 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 735.21000 |
| X_logP_energy | -11.88670 |
Interaction Information
| Affinity | KD=0.92 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2IVZ |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Competitive recruitment of the periplasmic translocation portal TolB by a natively disordered domain of colicin E9. |
| Release_Year | 2006 |
| PMID | 16894158 |
| DOI | 10.1073/pnas.0603433103 |