PPIRE11870
Target Protein Information
| Protein_Name | Peptidyl-prolyl cis-trans isomerase |
|---|---|
| Protein_Sequence | MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIQGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATSEELLHVH |
| Organism_Source | Thermus thermophilus |
| Functional_Classification | peptidyl-prolyl isomerase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | slyD |
| UniProt_ID | A0A3P4ASJ6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | S2-minus1 |
|---|---|
| Peptide_Sequence | GHQTRYWNPKMKPFI |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CN)[C@@H](C)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1903.23 |
|---|---|
| Aliphatic_Index | 26.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.86667 |
| Charge_at_pH_7 | 3.08745 |
| Isoelectric_Point | 10.90184 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 738.19000 |
| X_logP_energy | -4.44773 |
Interaction Information
| Affinity | KD=7.25 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD. |
| Release_Year | 2016 |
| PMID | 27664121 |
| DOI | 10.1186/s12915-016-0300-3 |