PPIRE11893
Target Protein Information
| Protein_Name | Interleukin-17A |
|---|---|
| Protein_Sequence | MSPGRASSVSLMLLLLLSLAATVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
| Organism_Source | Mus musculus |
| Functional_Classification | IL-17 family |
| Cellular_Localization | Extracellular |
| Gene_Names | Il17a |
| UniProt_ID | Q62386 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HAP |
|---|---|
| Peptide_Sequence | IHVTIPADLWDWINK |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1821.11 |
|---|---|
| Aliphatic_Index | 130.00000 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | -0.91051 |
| Isoelectric_Point | 5.40813 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 686.13000 |
| X_logP_energy | -1.69960 |
Interaction Information
| Affinity | KD=30.1 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibiting complex IL-17A and IL-17RA interactions with a linear peptide. |
| Release_Year | 2016 |
| PMID | 27184415 |
| DOI | 10.1038/srep26071 |