PPIRE11911
Target Protein Information
| Protein_Name | Proliferating cell nuclear antigen |
|---|---|
| Protein_Sequence | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | sliding clamp |
| Cellular_Localization | Nucleus |
| Gene_Names | PCNA |
| UniProt_ID | P12004 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p21mu-Pogo |
|---|---|
| Peptide_Sequence | KRRKKITDYFHFHSK |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1991.33 |
|---|---|
| Aliphatic_Index | 26.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 4.60000 |
| Charge_at_pH_7 | 5.17821 |
| Isoelectric_Point | 11.25439 |
|---|---|
| Hydrogen_Bond_Acceptors | 28 |
| Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 853.95000 |
| X_logP_energy | -6.51276 |
Interaction Information
| Affinity | KD=8.82 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Unlocking the PIP-box: A peptide library reveals interactions that drive high-affinity binding to human PCNA. |
| Release_Year | 2021 |
| PMID | 33984330 |
| DOI | 10.1016/j.jbc.2021.100773 |