PPIRE11944
Target Protein Information
| Protein_Name | HLA class II histocompatibility antigen, DRB1 beta chain |
|---|---|
| Protein_Sequence | MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class II |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-DRB1 |
| UniProt_ID | P01911 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 1 |
|---|---|
| Peptide_Sequence | MSILKIHAREIFDSR |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCSC)[C@@H](C)CC)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1816.15 |
|---|---|
| Aliphatic_Index | 110.66667 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 4.20000 |
| Charge_at_pH_7 | 1.09081 |
| Isoelectric_Point | 9.69216 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 28 |
| Topological_Polar_Surface_Area | 764.28000 |
| X_logP_energy | -5.66896 |
Interaction Information
| Affinity | IC50=3.5 uM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Functional and Structural Characterization of a Novel HLA-DRB1*04:01-Restricted Alpha-Enolase T Cell Epitope in Rheumatoid Arthritis. |
| Release_Year | 2016 |
| PMID | 27895642 |
| DOI | 10.3389/fimmu.2016.00494 |