PPIRE11973
Target Protein Information
| Protein_Name | Transcriptional enhancer factor TEF-3 |
|---|---|
| Protein_Sequence | MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
| Organism_Source | Homo sapiens |
| Functional_Classification | TEA domain transcription factors |
| Cellular_Localization | Nucleus |
| Gene_Names | TEAD4 |
| UniProt_ID | Q15561 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 6 |
|---|---|
| Peptide_Sequence | PXRLRKXPDSFXKPP |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | X2=6-chlorotryptophan; X7=norleucine; X12=1-naphthylalanine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1608.86 |
|---|---|
| Aliphatic_Index | 26.00000 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 3.26667 |
| Charge_at_pH_7 | 2.99783 |
| Isoelectric_Point | 11.65089 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 663.73000 |
| X_logP_energy | -7.43666 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure-based design of potent linear peptide inhibitors of the YAP-TEAD protein-protein interaction derived from the YAP omega-loop sequence. |
| Release_Year | 2019 |
| PMID | 31235263 |
| DOI | 10.1016/j.bmcl.2019.06.022 |