PPIRE11990
Target Protein Information
| Protein_Name | 14-3-3 protein sigma |
|---|---|
| Protein_Sequence | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Organism_Source | Homo sapiens |
| Functional_Classification | adapter proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SFN |
| UniProt_ID | P31947 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p53 CTD 15mer |
|---|---|
| Peptide_Sequence | RHKKLMFKTEGPDSD |
| Peptide_Length | 15 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1789.04 |
|---|---|
| Aliphatic_Index | 26.00000 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 4.13333 |
| Charge_at_pH_7 | 1.09067 |
| Isoelectric_Point | 9.44205 |
|---|---|
| Hydrogen_Bond_Acceptors | 27 |
| Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 782.93000 |
| X_logP_energy | -7.83163 |
Interaction Information
| Affinity | IC50=200 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Small-molecule stabilization of the p53 - 14-3-3 protein-protein interaction. |
| Release_Year | 2018 |
| PMID | 28640363 |
| DOI | 10.1002/1873-3468.12723 |