PPIRE12082
Target Protein Information
| Protein_Name | C3a anaphylatoxin chemotactic receptor |
|---|---|
| Protein_Sequence | MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | C3AR1 |
| UniProt_ID | Q16581 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | E1 |
|---|---|
| Peptide_Sequence | WWGKKYRASKLGLAR |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1820.17 |
|---|---|
| Aliphatic_Index | 65.33333 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 4.99624 |
| Isoelectric_Point | 11.76841 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 744.62000 |
| X_logP_energy | -4.11756 |
Interaction Information
| Affinity | IC50=10.9 nM |
|---|---|
| Affinity_Assay | degranulation assay |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | De novo peptide design with C3a receptor agonist and antagonist activities: theoretical predictions and experimental validation. |
| Release_Year | 2012 |
| PMID | 22500977 |
| DOI | 10.1021/jm201609k |