PPIRE12112
Target Protein Information
| Protein_Name | Streptavidin |
|---|---|
| Protein_Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Organism_Source | Streptomyces avidinii |
| Functional_Classification | biotin-binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P22629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Strep-tag II |
|---|---|
| Peptide_Sequence | NWSHPQFEK |
| Peptide_Length | 9 |
| Peptide_SMILES | NCCCC[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1172.27 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 3.88889 |
| Charge_at_pH_7 | 0.09037 |
| Isoelectric_Point | 7.54973 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 501.53000 |
| X_logP_energy | -4.15760 |
Interaction Information
| Affinity | KD=1 uM |
|---|---|
| Affinity_Assay | not specified |
| PDB_ID | 1KL3 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Improved affinity of engineered streptavidin for the Strep-tag II peptide is due to a fixed open conformation of the lid-like loop at the binding site. |
| Release_Year | 2002 |
| PMID | 11910031 |
| DOI | 10.1110/ps.4150102 |