PPIRE12213
Target Protein Information
| Protein_Name | Major prion protein |
|---|---|
| Protein_Sequence | MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG |
| Organism_Source | Mus musculus |
| Functional_Classification | GPI-anchored proteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Prnp |
| UniProt_ID | P04925 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide aptamer 8 |
|---|---|
| Peptide_Sequence | ARFEYLRDGYWVWRFT |
| Peptide_Length | 16 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)O)[C@@H](C)O)C(C)C |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2165.44 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.37500 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 0.99850 |
| Isoelectric_Point | 9.17050 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 852.39000 |
| X_logP_energy | -2.63619 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide aptamers expressed in the secretory pathway interfere with cellular PrPSc formation. |
| Release_Year | 2007 |
| PMID | 17574575 |
| DOI | 10.1016/j.jmb.2007.05.052 |