PPIRE12239
Target Protein Information
| Protein_Name | C-C chemokine receptor type 5 |
|---|---|
| Protein_Sequence | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CCR5 |
| UniProt_ID | P51681 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | R2.0_primary |
|---|---|
| Peptide_Sequence | CFPYITRPGTYHDXYO |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CS)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X15=1-naphthylalanine; O17=L-ornithine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1847.03 |
|---|---|
| Aliphatic_Index | 24.37500 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 3.12500 |
| Charge_at_pH_7 | 0.02481 |
| Isoelectric_Point | 7.34926 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 711.27000 |
| X_logP_energy | -5.89423 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular engineering of RANTES peptide mimetics with potent anti-HIV-1 activity. |
| Release_Year | 2011 |
| PMID | 21199933 |
| DOI | 10.1096/fj.10-167627 |