PPIRE12240
Target Protein Information
| Protein_Name | Major prion protein |
|---|---|
| Protein_Sequence | MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG |
| Organism_Source | Mus musculus |
| Functional_Classification | GPI-anchored proteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Prnp |
| UniProt_ID | P04925 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide aptamer 16 |
|---|---|
| Peptide_Sequence | CGRWAIRTVHIWLACG |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](N)CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)NCC(=O)O)[C@@H](C)CC)C(C)C)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1842.21 |
|---|---|
| Aliphatic_Index | 103.75000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.43750 |
| Charge_at_pH_7 | 1.96494 |
| Isoelectric_Point | 8.83790 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 704.11000 |
| X_logP_energy | -4.05206 |
Interaction Information
| Affinity | IC50=350 nM |
|---|---|
| Affinity_Assay | PK digestion immunoblot assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide aptamers expressed in the secretory pathway interfere with cellular PrPSc formation. |
| Release_Year | 2007 |
| PMID | 17574575 |
| DOI | 10.1016/j.jmb.2007.05.052 |