PPIRE12251
Target Protein Information
| Protein_Name | Metallothionein-3 |
|---|---|
| Protein_Sequence | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | metal-binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | MT3 |
| UniProt_ID | P25713 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Abeta1-16 |
|---|---|
| Peptide_Sequence | DAEFRHDSGYEVHHQK |
| Peptide_Length | 16 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1955.03 |
|---|---|
| Aliphatic_Index | 24.37500 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -1.72599 |
| Isoelectric_Point | 6.21394 |
|---|---|
| Hydrogen_Bond_Acceptors | 29 |
| Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 906.53000 |
| X_logP_energy | -9.60493 |
Interaction Information
| Affinity | KD=14 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Metal-dependent interactions of metallothionein-3 Beta-domain with amyloid-Beta peptide and related physiological implications. |
| Release_Year | 2019 |
| PMID | 31005822 |
| DOI | 10.1016/j.jinorgbio.2019.110693 |