PPIRE12286
Target Protein Information
| Protein_Name | Microtubule-associated protein 1 light chain 3 beta |
|---|---|
| Protein_Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
| Organism_Source | Homo sapiens |
| Functional_Classification | autophagy modifiers |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAP1LC3B |
| UniProt_ID | Q9GZQ8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | UBA5 LIR(333-348) |
|---|---|
| Peptide_Sequence | EIIHEDNEWGIELVSE |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1912.04 |
|---|---|
| Aliphatic_Index | 115.62500 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -5.90178 |
| Isoelectric_Point | 3.58854 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 831.41000 |
| X_logP_energy | -5.50170 |
Interaction Information
| Affinity | KD=2.3 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | An atypical LIR motif within UBA5 (ubiquitin like modifier activating enzyme 5)interacts with GABARAP proteins and mediates membrane localization of UBA5. |
| Release_Year | 2019 |
| PMID | 30990354 |
| DOI | 10.1080/15548627.2019.1606637 |