PPIRE12293
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | LEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | Major histocompatibility complex class II |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLADRB1 |
| UniProt_ID | Q07493 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Human serum albumin 106-120 |
|---|---|
| Peptide_Sequence | ETYGEMADCCAKQEPE |
| Peptide_Length | 16 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1803.95 |
|---|---|
| Aliphatic_Index | 12.50000 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 3.68750 |
| Charge_at_pH_7 | -4.11956 |
| Isoelectric_Point | 3.67190 |
|---|---|
| Hydrogen_Bond_Acceptors | 29 |
| Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 787.10000 |
| X_logP_energy | -8.88210 |
Interaction Information
| Affinity | IC50=1.41 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Purification and characterization of endogenous peptides extracted from HLA-DR isolated from the spleen of a patient with rheumatoid arthritis. |
| Release_Year | 1995 |
| PMID | 7539763 |
| DOI | 10.1002/eji.1830250553 |