PPIRE12320
Target Protein Information
| Protein_Name | Mitogen-activated protein kinase 14 |
|---|---|
| Protein_Sequence | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| Organism_Source | Homo sapiens |
| Functional_Classification | kinases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPK14 |
| UniProt_ID | Q16539 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | GRA24 KIM1 |
|---|---|
| Peptide_Sequence | GLLERRGVSELPPLYI |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)CN)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1812.14 |
|---|---|
| Aliphatic_Index | 140.00000 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 3.56250 |
| Charge_at_pH_7 | 0.00068 |
| Isoelectric_Point | 6.52661 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 721.10000 |
| X_logP_energy | -3.97126 |
Interaction Information
| Affinity | KD=1.6 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 5ETA |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural Basis for the Subversion of MAP Kinase Signaling by an Intrinsically Disordered Parasite Secreted Agonist. |
| Release_Year | 2016 |
| PMID | 27889209 |
| DOI | 10.1016/j.str.2016.10.011 |