PPIRE12377
Target Protein Information
| Protein_Name | Pancreatic alpha-amylase |
|---|---|
| Protein_Sequence | MKFVLLLSLIGFCWAQYDPHTADGRTAIVHLFEWRWADIAKECERYLAPKGFGGVQVSPPNENIIINNPSRPWWERYQPISYKICSRSGNENEFKDMVTRCNNVGVRIYVDAVINHMCGSGNSAGTHSTCGSYFNPNNREFSAVPYSAWYFNDNKCNGEINNYNDANQVRNCRLSGLLDLALDKDYVRTKVADYMNNLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPTDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRRTRNFQNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFANWWDNGSNQVAFSRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKVNGNCTGLKVNVGSDGKAHFSISNSAEDPFIAIHADSKL |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | glycoside hydrolases |
| Cellular_Localization | Extracellular |
| Gene_Names | Amy2 |
| UniProt_ID | P00689 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PBP9 |
|---|---|
| Peptide_Sequence | LSSLEMGSLGALFVCM |
| Peptide_Length | 16 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(C)C)C(C)C)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1658.02 |
|---|---|
| Aliphatic_Index | 121.87500 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 3.43750 |
| Charge_at_pH_7 | -1.06222 |
| Isoelectric_Point | 3.84996 |
|---|---|
| Hydrogen_Bond_Acceptors | 24 |
| Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 597.81000 |
| X_logP_energy | -4.68620 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The investigation of Alpha-amylase inhibitory activity of selected Pinto bean peptides via preclinical study using AR42J cell |
| Release_Year | 2017 |
| PMID | |
| DOI | 10.1016/j.jff.2017.06.037 |