PPIRE12429
Target Protein Information
| Protein_Name | Mitogen-activated protein kinase 1 |
|---|---|
| Protein_Sequence | MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS |
| Organism_Source | Homo sapiens |
| Functional_Classification | kinases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPK1 |
| UniProt_ID | P28482 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pepHePTP |
|---|---|
| Peptide_Sequence | RLQERRGSNVALMLDV |
| Peptide_Length | 16 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCCNC(=N)N)C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1857.16 |
|---|---|
| Aliphatic_Index | 115.62500 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.06250 |
| Charge_at_pH_7 | 1.00020 |
| Isoelectric_Point | 10.30864 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 866.53000 |
| X_logP_energy | -9.21249 |
Interaction Information
| Affinity | KD=5 mM |
|---|---|
| Affinity_Assay | not reported |
| PDB_ID | None |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Docking interactions induce exposure of activation loop in the MAP kinase ERK2. |
| Release_Year | 2006 |
| PMID | 16765894 |
| DOI | 10.1016/j.str.2006.04.006 |