PPIRE12430
Target Protein Information
| Protein_Name | Insulin-like growth factor 1 |
|---|---|
| Protein_Sequence | MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK |
| Organism_Source | Homo sapiens |
| Functional_Classification | growth factors |
| Cellular_Localization | Extracellular |
| Gene_Names | IGF1 |
| UniProt_ID | P05019 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | IGF-F1-1 |
|---|---|
| Peptide_Sequence | RNCFESVAALRRCMYG |
| Peptide_Length | 16 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CCCNC(=N)N)C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1876.20 |
|---|---|
| Aliphatic_Index | 55.00000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.81250 |
| Charge_at_pH_7 | 1.87495 |
| Isoelectric_Point | 8.80375 |
|---|---|
| Hydrogen_Bond_Acceptors | 27 |
| Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 806.37000 |
| X_logP_energy | -8.63039 |
Interaction Information
| Affinity | IC50=7.2 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | 1PMX |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Complex with a phage display-derived peptide provides insight into the function of insulin-like growth factor I. |
| Release_Year | 2003 |
| PMID | 12899619 |
| DOI | 10.1021/bi034386c |