PPIRE12471
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulin |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1 |
| UniProt_ID | P01868 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AbetapE3-18 |
|---|---|
| Peptide_Sequence | XFRHDSGYEVHHQKLV |
| Peptide_Length | 16 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)CN)C(C)C)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | X1=pyroglutamate |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Pyroglutamate |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1909.09 |
|---|---|
| Aliphatic_Index | 60.62500 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.87500 |
| Charge_at_pH_7 | 0.27178 |
| Isoelectric_Point | 7.80126 |
|---|---|
| Hydrogen_Bond_Acceptors | 27 |
| Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 831.93000 |
| X_logP_energy | -7.63083 |
Interaction Information
| Affinity | KD=6.85 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 5MYX |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and functional analyses of pyroglutamate-amyloid-Beta-specific antibodies as a basis for Alzheimer immunotherapy. |
| Release_Year | 2017 |
| PMID | 28623233 |
| DOI | 10.1074/jbc.M117.777839 |