PPIRE12563
Target Protein Information
| Protein_Name | Chromatin-associated protein swi6 |
|---|---|
| Protein_Sequence | MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE |
| Organism_Source | Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Functional_Classification | chromodomain proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | swi6 |
| UniProt_ID | P40381 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3K9me2 peptide |
|---|---|
| Peptide_Sequence | ARTKQTARXSTGGKAY |
| Peptide_Length | 16 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X9=dimethyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1652.83 |
|---|---|
| Aliphatic_Index | 18.75000 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 3.99654 |
| Isoelectric_Point | 11.67668 |
|---|---|
| Hydrogen_Bond_Acceptors | 27 |
| Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 819.90000 |
| X_logP_energy | -13.24276 |
Interaction Information
| Affinity | KD=10.28 mM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | High-affinity binding of Chp1 chromodomain to K9 methylated histone H3 is required to establish centromeric heterochromatin. |
| Release_Year | 2009 |
| PMID | 19362535 |
| DOI | 10.1016/j.molcel.2009.02.024 |