PPIRE12573
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulin |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1 |
| UniProt_ID | P01868 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Abeta2-18 |
|---|---|
| Peptide_Sequence | AEFRHDSGYEVHHQKLV |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)N)C(C)C)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2052.24 |
|---|---|
| Aliphatic_Index | 62.94118 |
| Aromaticity | 0.11765 |
| Average_Rotatable_Bonds | 3.94118 |
| Charge_at_pH_7 | -0.72644 |
| Isoelectric_Point | 6.79449 |
|---|---|
| Hydrogen_Bond_Acceptors | 29 |
| Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 898.33000 |
| X_logP_energy | -7.89273 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and functional analyses of pyroglutamate-amyloid-Beta-specific antibodies as a basis for Alzheimer immunotherapy. |
| Release_Year | 2017 |
| PMID | 28623233 |
| DOI | 10.1074/jbc.M117.777839 |