PPIRE12640
Target Protein Information
| Protein_Name | Phospholipase A2, membrane associated |
|---|---|
| Protein_Sequence | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC |
| Organism_Source | Homo sapiens |
| Functional_Classification | phospholipases |
| Cellular_Localization | Extracellular |
| Gene_Names | PLA2G2A |
| UniProt_ID | P14555 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 1(PIP-17) |
|---|---|
| Peptide_Sequence | LGRVDIHVWDGVYIRGR |
| Peptide_Length | 17 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](N)CC(C)C)C(C)C)[C@@H](C)CC)C(C)C)C(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2011.32 |
|---|---|
| Aliphatic_Index | 120.00000 |
| Aromaticity | 0.11765 |
| Average_Rotatable_Bonds | 3.76471 |
| Charge_at_pH_7 | 1.08893 |
| Isoelectric_Point | 9.34883 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 853.92000 |
| X_logP_energy | -5.46709 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Novel peptide inhibitors of human secretory phospholipase A2 with antiinflammatory activity: solution structure and molecular modeling. |
| Release_Year | 2007 |
| PMID | 17973469 |
| DOI | 10.1021/jm070385x |