PPIRE12644
Target Protein Information
| Protein_Name | Mitogen-activated protein kinase 1 |
|---|---|
| Protein_Sequence | MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS |
| Organism_Source | Homo sapiens |
| Functional_Classification | kinases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPK1 |
| UniProt_ID | P28482 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pepSynth-revD |
|---|---|
| Peptide_Sequence | LSLSSLAASSLAKRRQQ |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1816.09 |
|---|---|
| Aliphatic_Index | 109.41176 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.76471 |
| Charge_at_pH_7 | 2.99768 |
| Isoelectric_Point | 12.51648 |
|---|---|
| Hydrogen_Bond_Acceptors | 28 |
| Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 866.07000 |
| X_logP_energy | -12.45276 |
Interaction Information
| Affinity | KD=10 mM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Specificity of linear motifs that bind to a common mitogen-activated protein kinase docking groove. |
| Release_Year | 2012 |
| PMID | 23047924 |
| DOI | 10.1126/scisignal.2003004 |