PPIRE12664
Target Protein Information
| Protein_Name | 14-3-3 protein gamma |
|---|---|
| Protein_Sequence | MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN |
| Organism_Source | Homo sapiens |
| Functional_Classification | 14-3-3 proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAG |
| UniProt_ID | P61981 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CCDC8(494-510)-pT504 |
|---|---|
| Peptide_Sequence | RAFWHTPRLPXLPKRVP |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)O)C(C)C |
| Chemical_Modification | X11=phosphothreonine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2028.44 |
|---|---|
| Aliphatic_Index | 68.82353 |
| Aromaticity | 0.11765 |
| Average_Rotatable_Bonds | 3.35294 |
| Charge_at_pH_7 | 4.08859 |
| Isoelectric_Point | 12.80743 |
|---|---|
| Hydrogen_Bond_Acceptors | 24 |
| Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 770.18000 |
| X_logP_energy | -4.18849 |
Interaction Information
| Affinity | KD=0.3 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Ankyrin repeats of ANKRA2 recognize a PxLPxL motif on the 3M syndrome protein CCDC8. |
| Release_Year | 2015 |
| PMID | 25752541 |
| DOI | 10.1016/j.str.2015.02.001 |