PPIRE12679
Target Protein Information
| Protein_Name | IgG receptor FcRn large subunit p51 |
|---|---|
| Protein_Sequence | MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA |
| Organism_Source | Homo sapiens |
| Functional_Classification | Fc receptor |
| Cellular_Localization | Lysosome |
| Gene_Names | FCGRT |
| UniProt_ID | P55899 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SYN1753 |
|---|---|
| Peptide_Sequence | RYFCTKWKHGWCEEVGT |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)O)C(=O)NCC(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2130.43 |
|---|---|
| Aliphatic_Index | 17.05882 |
| Aromaticity | 0.23529 |
| Average_Rotatable_Bonds | 3.88235 |
| Charge_at_pH_7 | 0.96705 |
| Isoelectric_Point | 8.23118 |
|---|---|
| Hydrogen_Bond_Acceptors | 29 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 838.41000 |
| X_logP_energy | -5.44923 |
Interaction Information
| Affinity | KD=0.5 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 5BJT |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Hepatic FcRn regulates albumin homeostasis and susceptibility to liver injury. |
| Release_Year | 2017 |
| PMID | 28330995 |
| DOI | 10.1073/pnas.1618291114 |