PPIRE12690
Target Protein Information
| Protein_Name | D(2)dopamine receptor |
|---|---|
| Protein_Sequence | MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Drd2 |
| UniProt_ID | P61169 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ACTH(1-17) |
|---|---|
| Peptide_Sequence | SYSMEHFRWGKPVGKKR |
| Peptide_Length | 17 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2093.44 |
|---|---|
| Aliphatic_Index | 17.05882 |
| Aromaticity | 0.17647 |
| Average_Rotatable_Bonds | 4.05882 |
| Charge_at_pH_7 | 4.08893 |
| Isoelectric_Point | 11.11006 |
|---|---|
| Hydrogen_Bond_Acceptors | 29 |
| Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 864.45000 |
| X_logP_energy | -7.02306 |
Interaction Information
| Affinity | IC50=6 uM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding of opiates and endogenous opioid peptides to neuroleptic receptor sites in the corpus striatum. |
| Release_Year | 1978 |
| PMID | 205747 |
| DOI | 10.1016/0024-3205(78)90360-0 |