PPIRE12841
Target Protein Information
| Protein_Name | Troponin C, slow skeletal and cardiac muscles |
|---|---|
| Protein_Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |
| Organism_Source | Homo sapiens |
| Functional_Classification | calcium-binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TNNC1 |
| UniProt_ID | P63316 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SWH |
|---|---|
| Peptide_Sequence | ISADAMMQALLGARAKES |
| Peptide_Length | 18 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1863.18 |
|---|---|
| Aliphatic_Index | 92.77778 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.61111 |
| Charge_at_pH_7 | -0.00009 |
| Isoelectric_Point | 6.49432 |
|---|---|
| Hydrogen_Bond_Acceptors | 28 |
| Hydrogen_Bond_Donors | 28 |
| Topological_Polar_Surface_Area | 804.09000 |
| X_logP_energy | -9.00283 |
Interaction Information
| Affinity | KD=4.2 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 4Y99 |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure-based rational design of self-inhibitory peptides to disrupt the intermolecular interaction between the troponin subunits C and I in neuropathic pain. |
| Release_Year | 2017 |
| PMID | 28525735 |
| DOI | 10.1016/j.bioorg.2017.05.004 |