PPIRE12938
Target Protein Information
| Protein_Name | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|---|
| Protein_Sequence | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR |
| Organism_Source | Homo sapiens |
| Functional_Classification | Bcl-2 family proteins |
| Cellular_Localization | Mitochondrion |
| Gene_Names | MCL1 |
| UniProt_ID | Q07820 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Extended NoxaB peptide |
|---|---|
| Peptide_Sequence | AAQLRRIGDKVNLRQKLLN |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](C)N)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2206.62 |
|---|---|
| Aliphatic_Index | 128.42105 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.21053 |
| Charge_at_pH_7 | 3.99783 |
| Isoelectric_Point | 12.24366 |
|---|---|
| Hydrogen_Bond_Acceptors | 30 |
| Hydrogen_Bond_Donors | 36 |
| Topological_Polar_Surface_Area | 1034.52000 |
| X_logP_energy | -10.51329 |
Interaction Information
| Affinity | IC50=7.23 uM |
|---|---|
| Affinity_Assay | fluorescence anisotropy |
| PDB_ID | 2NLA |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide-Directed Binding for the Discovery of Modulators of Alpha-Helix-Mediated Protein-Protein Interactions: Proof-of-Concept Studies with the Apoptosis Regulator Mcl-1. |
| Release_Year | 2017 |
| PMID | 28670766 |
| DOI | 10.1002/anie.201705008 |