PPIRE12949
Target Protein Information
| Protein_Name | Chemotaxis protein CheY |
|---|---|
| Protein_Sequence | MADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFSFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM |
| Organism_Source | Salmonella enterica I |
| Functional_Classification | two-component response regulator |
| Cellular_Localization | Cytoplasm |
| Gene_Names | cheY |
| UniProt_ID | A0A8F6NJ74 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CheZC19_amide |
|---|---|
| Peptide_Sequence | AGVVASQDQVDDLLDSLGF |
| Peptide_Length | 19 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C)N)C(C)C)C(C)C)C(C)C)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1949.10 |
|---|---|
| Aliphatic_Index | 117.89474 |
| Aromaticity | 0.05263 |
| Average_Rotatable_Bonds | 3.36842 |
| Charge_at_pH_7 | -4.00023 |
| Isoelectric_Point | 3.22803 |
|---|---|
| Hydrogen_Bond_Acceptors | 28 |
| Hydrogen_Bond_Donors | 28 |
| Topological_Polar_Surface_Area | 862.96000 |
| X_logP_energy | -9.80930 |
Interaction Information
| Affinity | KD=7.9 uM |
|---|---|
| Affinity_Assay | intrinsic fluorescence spectroscopy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Interaction of CheY with the C-terminal peptide of CheZ. |
| Release_Year | 2008 |
| PMID | 18083806 |
| DOI | 10.1128/JB.01414-07 |